PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009600873.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 313aa    MW: 34773.4 Da    PI: 7.7529
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009600873.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.3e-1765110147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+W++eEd  l ++v q+G+++W++I+  ++ +R++k+c++rw + 
   XP_009600873.1  65 KGSWSPEEDAMLTKLVDQHGPRNWSLISIGIP-RRSGKSCRLRWCNQ 110
                      799*****************************.***********985 PP

2Myb_DNA-binding53.94.2e-17119161347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+ Ed ++++a+  +G++ W+tIar ++ gRt++ +k++w++ 
   XP_009600873.1 119 PFTPSEDAIILQAHSVHGNR-WATIARLLP-GRTDNAIKNHWNST 161
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.63560111IPR017930Myb domain
SuperFamilySSF466895.99E-3063158IPR009057Homeodomain-like
SMARTSM007179.9E-1564113IPR001005SANT/Myb domain
PfamPF002491.9E-1665110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-2366118IPR009057Homeodomain-like
CDDcd001677.78E-1467109No hitNo description
PROSITE profilePS5129425.288112166IPR017930Myb domain
SMARTSM007173.9E-15116164IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-23119165IPR009057Homeodomain-like
PfamPF002492.4E-14119161IPR001005SANT/Myb domain
CDDcd001671.42E-12119162No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MRAVYVSCQQ LLFPYGYCYA DHVTFTCSSS SSLPSFLFLN PNHLLPFILQ QIIYSMDNST  60
GEKIKGSWSP EEDAMLTKLV DQHGPRNWSL ISIGIPRRSG KSCRLRWCNQ LSPAVQHRPF  120
TPSEDAIILQ AHSVHGNRWA TIARLLPGRT DNAIKNHWNS TLRRKRHAPE AAAAAAATML  180
MGLDESRTGS SSESNSKRQC SRASQEQSSY GLDADDLGRN GPETSLTLSL PGGGLQQSHA  240
VDEKMVKDEV PPPINGDNKV KEEKCRVEIE ETCLVTIMQR MIAHEVRCYI DKLRAQGGLE  300
IVPGFESDVP KQP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-38621651104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009600873.10.0PREDICTED: transcription factor MYB44-like
TrEMBLA0A067LKB34e-92A0A067LKB3_JATCU; MYB family protein
STRINGVIT_13s0067g01360.t013e-82(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA128831620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-51myb domain protein 73